PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.68360s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 153aa    MW: 17981.8 Da    PI: 8.4755
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.68360s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM49.41.5e-151813010128
                   NAM  10 tdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                           +de ++++yLk  + + +   +++i ++++++ +P++L    + +e+   f + + +++a gk      +sg W+  g+dk ++s+ +g
  Araha.68360s0001.1.p  18 EDEVIISRYLKGMIVNGDSWPDHFIVDANVFNKNPNELF---N-SERP-RFVIVKPRTEACGKTDG--CESGCWRIMGRDKLIKSEeTG 99 
                           68899********98888666588**************6...2.3344.45555556666654444..479*************98778 PP

                   NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                           +  g kk+L f  +++p+  k +Wvm+eyrl
  Araha.68360s0001.1.p 100 KILGFKKILKFCPKSKPREYKRSWVMEEYRL 130
                           889**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100525.4849148IPR003441NAC domain
SuperFamilySSF1019411.06E-2818146IPR003441NAC domain
PfamPF023652.2E-918130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MENDAAYDLI KHELLNAEDE VIISRYLKGM IVNGDSWPDH FIVDANVFNK NPNELFNSER  60
PRFVIVKPRT EACGKTDGCE SGCWRIMGRD KLIKSEETGK ILGFKKILKF CPKSKPREYK  120
RSWVMEEYRL TKNLNWKQDH VICKIRLLFE AEI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHE6017510.0HE601751.1 Arabidopsis halleri subsp. halleri BAC clone 9G1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002886623.11e-102hypothetical protein ARALYDRAFT_338342
TrEMBLI0J3G61e-108I0J3G6_ARAHH; No apical meristem domain-containing protein
STRINGfgenesh1_pg.C_scaffold_20004411e-102(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37041459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G60340.16e-99NAC family protein